Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00152110-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00152110-M01, RRID:AB_534957
- Product name
- NEK10 monoclonal antibody (M01), clone 1C9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NEK10.
- Antigen sequence
RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSS
GAASLKSELSESADLPPEGFQASYGKDEDRACDEI
LSDDNFNLENAEKDTYSEVD- Isotype
- IgG
- Antibody clone number
- 1C9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NEK10 monoclonal antibody (M01), clone 1C9. Western Blot analysis of NEK10 expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody (M01), clone 1C9.Lane 1: NEK10 transfected lysate(53.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NEK10 monoclonal antibody (M01), clone 1C9. Western Blot analysis of NEK10 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NEK10 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NEK10 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
