HPA035118

GKAP1 antibody from Atlas Antibodies
FKSG21, GKAP42
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035118
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035118, RRID:AB_10671100
Product name
Anti-GKAP1
Provider product page
Atlas Antibodies - HPA035118
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQT
LSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTD
NCTAHEHNQALVLKDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -