SAB2100933

GLYAT antibody from MilliporeSigma / Merck KGaA
ACGNAT, GAT
No application information provided.

Antibody data

Product number
SAB2100933
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2100933, RRID:AB_10603151
Product name
Anti-GLYAT antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100933
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_964011.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQS
SQPSLNEAIQNLAAI
Storage
-20C
Provider Type Product Number
- No reagents -