HPA049517

PCIF1 antibody from Atlas Antibodies
bA465L10.1, C20orf67, PPP1R121
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA049517
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049517, RRID:AB_2680801
Product name
Anti-PCIF1
Provider product page
Atlas Antibodies - HPA049517
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEI
PVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAA
LLRPTEVYWDLDIQTNAVIKHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -