SAB1401001

ABCF1 antibody from Sigma-Aldrich
ABC50, EST123147
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1401001
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401001, RRID:AB_10608897
Product name
Anti-ABCF1 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401001
Antibody type
Polyclonal
Antigen
ABCF1 (AAH34488.1, 1 a.a. ~ 845 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDK
KIKKTFFEELAVEDKQAGEEEKVLKEKEQQQQQQQ
QQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLS
VPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQS
EEEEEEEKHPPKPAKPEKNRINKAVPEEQQPALKG
KKGKEEKSKGKAKPQNKFAALDNEEEDKEEEIIKE
KEPPKQGKEKAKKAEQGSEEEGEGEEEEEEGGESK
ADDPYAHLSK
Storage
-20C
Provider Type Product Number
- No reagents -