WH0006769M1

STAC antibody from Sigma-Aldrich
STAC1
ELISA
Recommended by provider

Antibody data

Product number
WH0006769M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0006769M1, RRID:AB_1843770
Product name
Monoclonal Anti-STAC antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0006769M1
Antibody type
Monoclonal
Antigen
STAC (AAH20221, a.a. 209-318) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
LAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGP
GGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQG
SLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIIT
LLEDS (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -