Antibody data

Product number
H00006769-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006769-M01, RRID:AB_607103
Product name
STAC monoclonal antibody (M01), clone 2C5
Provider product page
Abnova Corporation - H00006769-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STAC.
Antigen sequence
LAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGP
GGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQG
SLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIIT
LLEDS
Isotype
IgG
Antibody clone number
2C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -