Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083983-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083983-M02, RRID:AB_566257
- Product name
- TSSK6 monoclonal antibody (M02), clone 6F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TSSK6.
- Antigen sequence
SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTG
CMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKAL
IAELLQFSPSARPSAGQVARNCWLRAGDSG- Isotype
- IgG
- Antibody clone number
- 6F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis.
Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM
Molecular human reproduction 2011 Jan;17(1):42-56
Molecular human reproduction 2011 Jan;17(1):42-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TSSK6 monoclonal antibody (M02), clone 6F5 Western Blot analysis of TSSK6 expression in Hela S3 NE ( Cat # L013V3 ).