SAB1401011

SLC25A4 antibody from Sigma-Aldrich
ANT1, PEO2, PEO3, T1
No application information provided.

Antibody data

Product number
SAB1401011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401011, RRID:AB_10609319
Product name
Anti-SLC25A4 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401011
Antibody type
Polyclonal
Antigen
SLC25A4 (NP_001142.2, 1 a.a. ~ 298 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLL
LQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSF
WRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDR
HKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
LAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQ
GFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHI
FVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRK
GADIMYTGTV
Storage
-20C
Provider Type Product Number
- No reagents -