WH0000291M1

SLC25A4 antibody from Sigma-Aldrich
ANT1, PEO2, PEO3, T1
ELISA
Recommended by provider

Antibody data

Product number
WH0000291M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0000291M1, RRID:AB_1839410
Product name
Monoclonal Anti-SLC25A4 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0000291M1
Antibody type
Monoclonal
Antigen
SLC25A4 (AAH08664, a.a. 1-299) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLL
LRVQHASRQISAEKQYKGIIDCVVRIPKEQGFLSF
WRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDR
HKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
LAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQ
GFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHI
FVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRK
GADIMYTGTV (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -