Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501409 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Channel, Subfamily K, Member 4 (KCNK4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQA
QRELG EVREKFLRAH- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references 5-HTTLPR genotype and gender, but not chronic fluoxetine administration, are associated with cortical TREK1 protein expression in rhesus macaques.
The LIFEdb database in 2006.
Bogdan R, Fitzgibbon H, Woolverton WL, Bethea CL, Iyo AH, Stockmeier CA, Kyle PB, Austin MC
Neuroscience letters 2011 Oct 3;503(2):83-6
Neuroscience letters 2011 Oct 3;503(2):83-6
The LIFEdb database in 2006.
Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
No comments: Submit comment
No validations: Submit validation data