Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007103-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007103-M02, RRID:AB_566255
- Product name
- TSPAN8 monoclonal antibody (M02), clone 1E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TSPAN8.
- Antigen sequence
KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIV
FQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQR
PCQSYNGKQVYKETCISFIKDFLAKN- Isotype
- IgG
- Antibody clone number
- 1E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH
Clinical & experimental metastasis 2008;25(5):537-48
Clinical & experimental metastasis 2008;25(5):537-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TSPAN8 expression in transfected 293T cell line by TSPAN8 monoclonal antibody (M02), clone 1E5.Lane 1: TSPAN8 transfected lysate (Predicted MW: 26.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TSPAN8 on 293 cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol