HPA065337

antibody from Atlas Antibodies

Targeting: EML4 C2orf2, ELP120, ROPP120

Antibody data

Submit

Validation data

Product number: HPA065337 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA065337, RRID:AB_2685474
Product name: Anti-EML4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDG SVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPERE IEVPDQYGTI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EML4 protein structure - HPA065337 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human appendix and cerebral cortex tissues using Anti-EML4 antibody. Corresponding EML4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, gallbladder, kidney and lymph node using Anti-EML4 antibody HPA065337 (A) shows similar protein distribution across tissues to independent antibody HPA036687 (B).
Antibody #2 product nr: HPA036688, HPA036687
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human appendix shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-EML4 antibody HPA065337.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder using Anti-EML4 antibody HPA065337.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-EML4 antibody HPA065337.
Sample type: HUMAN