HPA024334

antibody from Atlas Antibodies

Targeting: GDAP1 CMT2K, CMT4, CMT4A

Antibody data

Submit

Validation data

Product number: HPA024334 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA024334, RRID:AB_1849583
Product name: Anti-GDAP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ILHPELTVDSMIPAYATTRIRSQIGNTESELKKLA EENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILD ELEKVLDQVETELQRRNEETPEEGQQPWLCGESFT LADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYY ERV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GDAP1 protein structure - HPA024334 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GDAP1 antibody. Corresponding GDAP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, liver, pancreas and testis using Anti-GDAP1 antibody HPA024334 (A) shows similar protein distribution across tissues to independent antibody HPA014266 (B).
Antibody #2 product nr: HPA014266
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-GDAP1 antibody HPA024334.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum using Anti-GDAP1 antibody HPA024334.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-GDAP1 antibody HPA024334.
Sample type: HUMAN