AV43088

WWP2 antibody from MilliporeSigma / Merck KGaA
AIP2
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV43088
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV43088, RRID:AB_1858870
Product name
Anti-WWP2 (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV43088
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human WWP2 with an internal ID of P25063
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQF
RFLCHSNALPSHVKI
Storage
-20C
Provider Type Product Number
- No reagents -