H00006677-A01

SPAM1 antibody from Abnova Corporation
HYAL5, PH-20, SPAG15
No application information provided.

Antibody data

Product number
H00006677-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006677-A01, RRID:AB_894274
Product name
SPAM1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00006677-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SPAM1.
Antigen sequence
RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVL
CQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKF
TVRGKPTLEDLEQFSEKFYCSCYSTLSCKE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -