ABIN311357

ZNF781 antibody from antibodies-online
FLJ37549
Western blot
Data presented on provider website

Antibody data

Product number
ABIN311357
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 781 (ZNF781) (N-Term) antibody
Provider product page
antibodies-online - ABIN311357
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF781 antibody: synthetic peptide directed towards the N terminal of human ZNF781
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQ
ICGKP FRKRAHLTQH
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.