AV50806

ZNF781 antibody from MilliporeSigma / Merck KGaA
FLJ37549
No application information provided.

Antibody data

Product number
AV50806
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV50806, RRID:AB_1859452
Product name
Anti-ZNF781 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV50806
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF781 with an internal ID of P13994
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQ
ICGKPFRKRAHLTQH
Storage
-20C
Provider Type Product Number
- No reagents -