WH0002034M1

EPAS1 antibody from MilliporeSigma / Merck KGaA
bHLHe73, HIF2A, HLF, MOP2, PASD2
ELISA
Recommended by provider

Antibody data

Product number
WH0002034M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0002034M1, RRID:AB_1841945
Product name
Monoclonal Anti-EPAS1 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0002034M1
Antibody type
Monoclonal
Antigen
EPAS1 (AAH15869, a.a. 1-102) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MVFHTAHLDISRTTMRWFRREFMQMRGQKWYSDPA
HVLQAHDLGAPWSWTEEEAAQRESSWSRPALQPPL
SRQPDGPARPPGMAPSHRPWLRSLGRSVTCR* (w
ithout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -