H00002894-A01

GRID1 antibody from Abnova Corporation
GluD1, KIAA1220
No application information provided.

Antibody data

Product number
H00002894-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002894-A01, RRID:AB_462907
Product name
GRID1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00002894-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant GRID1.
Antigen sequence
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEF
REDSSNPYVQFEILGTTYSETFGKDMRKLATWDSE
KGLNGSLQERPMGSRLQGLTLKV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -