Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009023-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009023-A01, RRID:AB_529750
- Product name
- CH25H polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CH25H.
- Antigen sequence
VNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHD
LHHSHFNCNFAPYFTHWDKILGTLRTASVPAR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased 25-hydroxycholesterol concentrations in the lungs of patients with chronic obstructive pulmonary disease.
Sugiura H, Koarai A, Ichikawa T, Minakata Y, Matsunaga K, Hirano T, Akamatsu K, Yanagisawa S, Furusawa M, Uno Y, Yamasaki M, Satomi Y, Ichinose M
Respirology (Carlton, Vic.) 2012 Apr;17(3):533-40
Respirology (Carlton, Vic.) 2012 Apr;17(3):533-40
No comments: Submit comment
No validations: Submit validation data