WH0007547M5

ZIC3 antibody from MilliporeSigma / Merck KGaA
HTX, HTX1, ZNF203
ELISA
Recommended by provider

Antibody data

Product number
WH0007547M5
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0007547M5, RRID:AB_1844271
Product name
Monoclonal Anti-ZIC3 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0007547M5
Antibody type
Monoclonal
Antigen
ZIC3 (NP_003404, a.a. 182-274) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQF
PNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQEL
SCKWIDEAQLSRPKKSCDRTFST (without GS
T)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -