Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007547-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007547-M05, RRID:AB_733265
- Product name
- ZIC3 monoclonal antibody (M05), clone 2C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZIC3.
- Antigen sequence
NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQF
PNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQEL
SCKWIDEAQLSRPKKSCDRTFST- Isotype
- IgG
- Antibody clone number
- 2C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZIC3 monoclonal antibody (M05), clone 2C1. Western Blot analysis of ZIC3 expression in human Skeletal muscle.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ZIC3 monoclonal antibody (M05), clone 2C1 Western Blot analysis of ZIC3 expression in Y-79 ( Cat # L042V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ZIC3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol