H00010312-M01
antibody from Abnova Corporation
Targeting: TCIRG1
a3, Atp6i, ATP6N1C, ATP6V0A3, OC-116, OC116, TIRC7
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010312-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010312-M01, RRID:AB_464374
- Product name
- TCIRG1 monoclonal antibody (M01), clone 6H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TCIRG1.
- Antigen sequence
QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLL
QAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRAC
RGFLIASFRELEQPLEHPVTGEPATWMTFL- Isotype
- IgG
- Antibody clone number
- 6H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A specific subtype of osteoclasts secretes factors inducing nodule formation by osteoblasts.
Impaired gastric acidification negatively affects calcium homeostasis and bone mass.
Differential localization of vacuolar H+-ATPases containing a1, a2, a3, or a4 (ATP6V0A1-4) subunit isoforms along the nephron.
Henriksen K, Andreassen KV, Thudium CS, Gudmann KN, Moscatelli I, Crüger-Hansen CE, Schulz AS, Dziegiel MH, Richter J, Karsdal MA, Neutzsky-Wulff AV
Bone 2012 Sep;51(3):353-61
Bone 2012 Sep;51(3):353-61
Impaired gastric acidification negatively affects calcium homeostasis and bone mass.
Schinke T, Schilling AF, Baranowsky A, Seitz S, Marshall RP, Linn T, Blaeker M, Huebner AK, Schulz A, Simon R, Gebauer M, Priemel M, Kornak U, Perkovic S, Barvencik F, Beil FT, Del Fattore A, Frattini A, Streichert T, Pueschel K, Villa A, Debatin KM, Rueger JM, Teti A, Zustin J, Sauter G, Amling M
Nature medicine 2009 Jun;15(6):674-81
Nature medicine 2009 Jun;15(6):674-81
Differential localization of vacuolar H+-ATPases containing a1, a2, a3, or a4 (ATP6V0A1-4) subunit isoforms along the nephron.
Schulz N, Dave MH, Stehberger PA, Chau T, Wagner CA
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2007;20(1-4):109-20
Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2007;20(1-4):109-20
No comments: Submit comment
No validations: Submit validation data