HPA062230

MAGEC2 antibody from Atlas Antibodies
CT10, HCA587, MAGE-C2, MAGEE1

Antibody data

Product number
HPA062230
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062230, RRID:AB_2684718
Product name
Anti-MAGEC2
Provider product page
Atlas Antibodies - HPA062230
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEE
EASSASSTLYLVFSPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.