H00051438-B01P

MAGEC2 antibody from Abnova Corporation
CT10, HCA587, MAGE-C2, MAGEE1

Antibody data

Product number
H00051438-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051438-B01P, RRID:AB_10755786
Product name
MAGEC2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051438-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MAGEC2 protein.
Antigen sequence
MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEE
EEEASSASSTLYLVFSPSSFSTSSSLILGGPEEEE
VPSGVIPNLTESIPSSPPQGPPQGPSQSPLSSCCS
SFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYT
LDEKVAELVEFLLLKYEAEEPVTEAEMLMIVIKYK
DYFPVILKRAREFMELLFGLALIEVGPDHFCVFAN
TVGLTDEGSDDEGMPENSLLIIILSVIFIKGNCAS
EEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQ
GHYLEYREVPHSSPPYYEFLWGPRAHSESIKKKVL
EFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDT
ADDATVMASESLSVMSSNVSFSE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.