HPA038467

PPP6R3 antibody from Atlas Antibodies
C11orf23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558, MGC125711, MGC125712, PP6R3, SAP190, SAPL, SAPLa, SAPS3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA038467
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038467, RRID:AB_2676029
Product name
Anti-PPP6R3
Provider product page
Atlas Antibodies - HPA038467
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDV
PMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFS
EFTSSLSTKDSLRSNSPVEMETSTEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -