Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023479-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023479-M01, RRID:AB_425907
- Product name
- NIFUN monoclonal antibody (M01), clone 3B8-1C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NIFUN.
- Antigen sequence
RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVG
TGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGC
GSAIASSSLATEWVKGKTVEEALTIKNTDIAKELC
LPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAE
KK- Isotype
- IgG
- Antibody clone number
- 3B8-1C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Metabolic adaptation to chronic hypoxia in cardiac mitochondria.
Heather LC, Cole MA, Tan JJ, Ambrose LJ, Pope S, Abd-Jamil AH, Carter EE, Dodd MS, Yeoh KK, Schofield CJ, Clarke K
Basic research in cardiology 2012 May;107(3):268
Basic research in cardiology 2012 May;107(3):268
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NIFUN monoclonal antibody (M01), clone 3B8-1C4 Western Blot analysis of NIFUN expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NIFUN is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NIFUN on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
