SAB1401516

POP7 antibody from MilliporeSigma / Merck KGaA
RPP2, RPP20
ELISA
Recommended by provider

Antibody data

Product number
SAB1401516
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-POP7 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401516
Antibody type
Monoclonal
Antigen
POP7 (NP_005828, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPN
DIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY
IHGLGLAINH*
Isotype
IgG
Storage
-20C