HPA034991

AFTPH antibody from MilliporeSigma / Merck KGaA
FLJ20080, FLJ23793, MGC33965, Nbla10388
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034991
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034991, RRID:AB_10603577
Product name
Anti-AFTPH antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034991
Antibody type
Polyclonal
Antigen
aftiphilin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RENNKINRVNELNSVKEVALGRSLDNKGDTDGEDQ
VCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQ
SK
Storage
-20C
Provider Type Product Number
- No reagents -