HPA037919

antibody from Atlas Antibodies

Targeting: AAMDC C11orf67, CK067, FLJ21035, PTD015

Antibody data

Submit

Validation data

Product number: HPA037919 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037919, RRID:AB_2675738
Product name: Anti-AAMDC
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRV LQTEQAVKEYNALVAQGVRVGGVFHSTC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AAMDC protein structure - HPA037919 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, liver, lymph node and testis using Anti-AAMDC antibody HPA037919 (A) shows similar protein distribution across tissues to independent antibody HPA037918 (B).
Antibody #2 product nr: HPA037918
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in Leydig cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-AAMDC antibody HPA037919.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-AAMDC antibody HPA037919.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland using Anti-AAMDC antibody HPA037919.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-AAMDC antibody HPA037919.
Sample type: HUMAN