Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002707-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002707-M01, RRID:AB_425450
- Product name
- GJB3 monoclonal antibody (M01), clone 3B4-1B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GJB3.
- Antigen sequence
MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLV
YVVAAERVWGDEQKDFDCNTKQPGCTNVCYDNYFP
ISNIRLWALQLIFVTCPSLLVILHVAYREERERRH
RQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLI
IEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVD
CYIARPTEKKIFTYFMVGASAVCIVLTICELCYLI
CHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKL
VEAGEVDPDPGNNKLQASAPNLTPI- Isotype
- IgG
- Antibody clone number
- 3B4-1B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references EKV mutant connexin 31 associated cell death is mediated by ER stress.
Tattersall D, Scott CA, Gray C, Zicha D, Kelsell DP
Human molecular genetics 2009 Dec 15;18(24):4734-45
Human molecular genetics 2009 Dec 15;18(24):4734-45
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GJB3 monoclonal antibody (M01), clone 3B4-1B3 Western Blot analysis of GJB3 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GJB3 expression in transfected 293T cell line by GJB3 monoclonal antibody (M01), clone 3B4-1B3.Lane 1: GJB3 transfected lysate(31 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GJB3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to GJB3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol