Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022797-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022797-M08, RRID:AB_1137493
- Product name
- TFEC monoclonal antibody (M08), clone 4F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TFEC.
- Antigen sequence
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDS
DAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYS
GEQGISPINMGLTSASCPS- Isotype
- IgG
- Antibody clone number
- 4F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TFEC expression in transfected 293T cell line by TFEC monoclonal antibody (M08), clone 4F11.Lane 1: TFEC transfected lysate(22.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TFEC is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol