ABIN504548

AGO3 antibody from antibodies-online
EIF2C3, FLJ12765, hAGO3

Antibody data

Product number
ABIN504548
Provider
antibodies-online
Product name
anti-Eukaryotic Translation Initiation Factor 2C3 (EIF2C3) (N-Term) antibody
Provider product page
antibodies-online - ABIN504548
Antibody type
Polyclonal
Antigen
The immunogen for anti-EIF2C3 antibody: synthetic peptide directed towards the N terminal of human EIF2C3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
Host
Rabbit
Antigen sequence
MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVE
VTHCG TMRRKYRVCN
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -