Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487194 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 9 (ABCB9) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ABCB9 antibody: synthetic peptide directed towards the N terminal of human ABCB9
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLE
DIRHF NIFDSVLDLW- Vial size
- 50 µg
Submitted references The effect of caveolin-1 (Cav-1) on fatty acid uptake and CD36 localization and lipotoxicity in vascular smooth muscle (VSM) cells.
Biochemical characterization of transporter associated with antigen processing (TAP)-like (ABCB9) expressed in insect cells.
Mattern HM, Raikar LS, Hardin CD
International journal of physiology, pathophysiology and pharmacology 2009;1(1):1-14
International journal of physiology, pathophysiology and pharmacology 2009;1(1):1-14
Biochemical characterization of transporter associated with antigen processing (TAP)-like (ABCB9) expressed in insect cells.
Ohara T, Ohashi-Kobayashi A, Maeda M
Biological & pharmaceutical bulletin 2008 Jan;31(1):1-5
Biological & pharmaceutical bulletin 2008 Jan;31(1):1-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting