H00023499-M01
antibody from Abnova Corporation
Targeting: MACF1
ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023499-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023499-M01, RRID:AB_509192
- Product name
- MACF1 monoclonal antibody (M01), clone 6G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MACF1.
- Antigen sequence
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQ
QLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRA
RGRTNIELREKFILPEGASQGMTPF- Isotype
- IgG
- Antibody clone number
- 6G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Laminin-based cell adhesion anchors microtubule plus ends to the epithelial cell basal cortex through LL5alpha/beta.
Hotta A, Kawakatsu T, Nakatani T, Sato T, Matsui C, Sukezane T, Akagi T, Hamaji T, Grigoriev I, Akhmanova A, Takai Y, Mimori-Kiyosue Y
The Journal of cell biology 2010 May 31;189(5):901-17
The Journal of cell biology 2010 May 31;189(5):901-17
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MACF1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol