HPA066285

SCARB1 antibody from Atlas Antibodies
CD36L1, CLA-1, CLA1, SR-BI, SRB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA066285
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA066285, RRID:AB_2685649
Product name
Anti-SCARB1
Provider product page
Atlas Antibodies - HPA066285
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGE
KPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYR
TFQFQPSKSHGSESDYIVMPNILVLGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -