H00025996-A01

REXO2 antibody from Abnova Corporation
CGI-114, DKFZP566E144, SFN
No application information provided.

Antibody data

Product number
H00025996-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025996-A01, RRID:AB_563287
Product name
REXO2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00025996-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant REXO2.
Antigen sequence
HGRSGLTKAVKESTITLQQAEYEFLSFVRQQTPPG
LCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVS
TVKELCRRWYPEEYEFAPKKAASHRALDDISESIK
ELQFY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -