SAB2102404

TEKT4 antibody from MilliporeSigma / Merck KGaA
MGC27019
No application information provided.

Antibody data

Product number
SAB2102404
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2102404, RRID:AB_10600668
Product name
Anti-TEKT4 (ab1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102404
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_653306.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQ
QLATETQALAQRTQQ
Storage
-20C
Provider Type Product Number
- No reagents -