Antibody data

Product number
H00004884-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004884-M06, RRID:AB_10753665
Product name
NPTX1 monoclonal antibody (M06), clone 7E6
Provider product page
Abnova Corporation - H00004884-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NPTX1.
Antigen sequence
KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELER
QVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQ
RISELEKGQKDNRPGDKFQLTFPLRTNYMY
Isotype
IgG
Antibody clone number
7E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.