HPA034958

TFPT antibody from Atlas Antibodies
amida, FB1, INO80F
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA034958
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA034958, RRID:AB_10603036
Product name
Anti-TFPT
Provider product page
Atlas Antibodies - HPA034958
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQF
TIVLEDEGSQGTDAPTPGNAENEPPEKETLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -