HPA034958

TFPT antibody from Sigma-Aldrich
amida, FB1, INO80F
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034958
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA034958, RRID:AB_10603036
Product name
Anti-TFPT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA034958
Antibody type
Polyclonal
Antigen
TCF3 (E2A) fusion partner (in childhood Leukemia) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQF
TIVLEDEGSQGTDAPTPGNAENEPPEKETLS
Storage
-20C
Provider Type Product Number
- No reagents -