Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000308-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000308-M01, RRID:AB_425305
- Product name
- ANXA5 monoclonal antibody (M01), clone 1F4-1A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ANXA5.
- Antigen sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDE
ESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLK
SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGT
NEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDD
VVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQD
AQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVF
DKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIR
SIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEID
LFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLL
CGEDD- Isotype
- IgG
- Antibody clone number
- 1F4-1A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells.
Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: a pilot Proteomics-based study.
Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY
Journal of proteomics 2012 Feb 2;75(4):1170-80
Journal of proteomics 2012 Feb 2;75(4):1170-80
Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: a pilot Proteomics-based study.
Zhou D, Luo N, Wu Q, You Y, Zhai Z, Mou Z, Wu Y, Hao F
Biochemical and biophysical research communications 2012 Apr 6;420(2):357-63
Biochemical and biophysical research communications 2012 Apr 6;420(2):357-63
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody (M01), clone 1F4-1A5.Lane 1: ANXA5 transfected lysate(35.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Western Blot analysis of ANXA5 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ANXA5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ANXA5 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
