Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001027-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001027-M01, RRID:AB_425362
- Product name
- CDKN1B monoclonal antibody (M01), clone 4B4-E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CDKN1B.
- Antigen sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGP
VDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL
EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQE
SQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS
QTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVS
DGSPNAGSVEQTPKKPGLRRRQT- Isotype
- IgG
- Antibody clone number
- 4B4-E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CDKN1B expression in transfected 293T cell line by CDKN1B monoclonal antibody (M01), clone 4B4-E6.Lane 1: CDKN1B transfected lysate(22.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CDKN1B is 10 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CDKN1B is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CDKN1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between AKT1 and CDKN1B. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-CDKN1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
