Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405693 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LRP8 antibody: synthetic peptide directed towards the middle region of human LRP8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSD
WGDQA KIEKSGLNGV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Fyn modulation of Dab1 effects on amyloid precursor protein and ApoE receptor 2 processing.
Hoe HS, Minami SS, Makarova A, Lee J, Hyman BT, Matsuoka Y, Rebeck GW
The Journal of biological chemistry 2008 Mar 7;283(10):6288-99
The Journal of biological chemistry 2008 Mar 7;283(10):6288-99
No comments: Submit comment
No validations: Submit validation data