HPA030401

antibody from Atlas Antibodies

Targeting: TXLNB C6orf198, dJ522B19.2, DKFZp451A175, MDP77

Antibody data

Submit

Validation data

Product number: HPA030401 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030401, RRID:AB_2673459
Product name: Anti-TXLNB
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCE GLPVGAQADQASWKPEAEASGQAPQAPTEASLQKM EADVPAPACAAEEHVAAM
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TXLNB protein structure - HPA030401 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-TXLNB antibody. Corresponding TXLNB RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, skeletal muscle and testis using Anti-TXLNB antibody HPA030401 (A) shows similar protein distribution across tissues to independent antibody HPA030403 (B).
Antibody #2 product nr: HPA030403
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-TXLNB antibody HPA030401.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-TXLNB antibody HPA030401.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TXLNB antibody HPA030401.
Sample type: HUMAN