Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023648-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023648-M01, RRID:AB_489919
- Product name
- SSBP3 monoclonal antibody (M01), clone 3E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SSBP3.
- Antigen sequence
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQK
SAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY
CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVL- Isotype
- IgG
- Antibody clone number
- 3E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteasomal selection of multiprotein complexes recruited by LIM homeodomain transcription factors.
Güngör C, Taniguchi-Ishigaki N, Ma H, Drung A, Tursun B, Ostendorff HP, Bossenz M, Becker CG, Becker T, Bach I
Proceedings of the National Academy of Sciences of the United States of America 2007 Sep 18;104(38):15000-5
Proceedings of the National Academy of Sciences of the United States of America 2007 Sep 18;104(38):15000-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SSBP3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol