HPA028501

antibody from Atlas Antibodies

Targeting: L1TD1 ECAT11, FLJ10884

Antibody data

Submit

Validation data

Product number: HPA028501 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA028501, RRID:AB_10599287
Product name: Anti-L1TD1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IDSVEDSESEEEEEGKSSETGKVKTTSLTEKKASR RQKEIPFSYLVGDSGKKKLVKHQVVHKTQEEEETA VPTSQGTGTPC
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

L1TD1 protein structure - HPA028501 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and cervix, uterine tissues using HPA028501 antibody. Corresponding L1TD1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows no positivity in stromal cells as expected.
Sample type: HUMAN