HPA053247

IFI44L antibody from Atlas Antibodies
C1orf29, GS3686

Antibody data

Product number
HPA053247
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA053247, RRID:AB_2682088
Product name
Anti-IFI44L
Provider product page
Atlas Antibodies - HPA053247
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAF
MLGNYINLHESSTEPNDSLWFSLQKKNDTTEIETL
LLNTAP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -