ABIN310784

IFI44L antibody from antibodies-online
C1orf29, GS3686
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN310784
Provider
antibodies-online
Product name
anti-Interferon-Induced Protein 44-Like (IFI44L) (N-Term) antibody
Provider product page
antibodies-online - ABIN310784
Antibody type
Polyclonal
Antigen
The immunogen for anti-IFI44L antibody: synthetic peptide directed towards the N terminal of human IFI44L
Description
Protein A purified
Reactivity
Human
Host
Rabbit
Antigen sequence
MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGG
SIEDM VERCSRQGCT
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -